Recombinant Full Length Human Cytochrome B561 Domain-Containing Protein 2(Cyb561D2) Protein, His-Tagged
| Cat.No. : | RFL22350HF |
| Product Overview : | Recombinant Full Length Human Cytochrome b561 domain-containing protein 2(CYB561D2) Protein (O14569) (2-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-222) |
| Form : | Lyophilized powder |
| AA Sequence : | ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMT EALLVFSPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLVTRHG QAGLLAVLWAGLQCSGGVGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCSL WFTASVTGAAWYLAVLCPVLTSLVIMNQVSNAYLYRKRIQP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CYB561D2 |
| Synonyms | CYB561D2; 101F6; LUCA12.2; Transmembrane reductase CYB561D2; Cytochrome b561 domain-containing protein 2; Putative tumor suppressor protein 101F6 |
| UniProt ID | O14569 |
| ◆ Recombinant Proteins | ||
| CYB561D2-1358R | Recombinant Rat CYB561D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYB561D2-4121M | Recombinant Mouse CYB561D2 Protein | +Inquiry |
| CYB561D2-2211H | Recombinant Human CYB561D2 Protein, GST-tagged | +Inquiry |
| RFL22350HF | Recombinant Full Length Human Cytochrome B561 Domain-Containing Protein 2(Cyb561D2) Protein, His-Tagged | +Inquiry |
| RFL27412MF | Recombinant Full Length Mouse Cytochrome B561 Domain-Containing Protein 2(Cyb561D2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYB561D2-7147HCL | Recombinant Human CYB561D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB561D2 Products
Required fields are marked with *
My Review for All CYB561D2 Products
Required fields are marked with *
