Recombinant Full Length Human D2HGDH Protein, C-Flag-tagged
Cat.No. : | D2HGDH-1752HFL |
Product Overview : | Recombinant Full Length Human D2HGDH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.8 kDa |
AA Sequence : | MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVQRLPFSTVSKQDLAAF ERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSV PVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGG LRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVN VAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNAGHD AEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVYKYDLSLPVERLYDIVTDLRA RLGPHAKHVVGYGHLGDGNLHLNVTAEAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSK PPGALQLMQQLKALLDPKGILNPYKTLPSQATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | D2HGDH D-2-hydroxyglutarate dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | D2HGDH |
Synonyms | D2HGD |
Gene ID | 728294 |
mRNA Refseq | NM_152783.5 |
Protein Refseq | NP_689996.4 |
MIM | 609186 |
UniProt ID | Q8N465 |
◆ Recombinant Proteins | ||
D2HGDH-969D | Recombinant Zebrafish D2HGDH Protein (56-533 aa), His-SUMO-tagged | +Inquiry |
D2HGDH-1752HFL | Recombinant Full Length Human D2HGDH Protein, C-Flag-tagged | +Inquiry |
D2HGDH-2214H | Recombinant Human D2HGDH Protein (Arg56-Asp232), N-His tagged | +Inquiry |
D2HGDH-4269M | Recombinant Mouse D2HGDH Protein | +Inquiry |
D2HGDH-4339H | Recombinant Human D2HGDH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
D2HGDH-7088HCL | Recombinant Human D2HGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All D2HGDH Products
Required fields are marked with *
My Review for All D2HGDH Products
Required fields are marked with *
0
Inquiry Basket