Recombinant Full Length Human DAB1 Protein, GST-tagged
Cat.No. : | DAB1-2519HF |
Product Overview : | Human DAB1 full-length ORF ( AAH67445.1, 1 a.a. - 553 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 553 amino acids |
Description : | The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. [provided by RefSeq, Jan 2017] |
Molecular Mass : | 86 kDa |
AA Sequence : | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAB1 disabled homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | DAB1 |
Synonyms | DAB1; disabled homolog 1 (Drosophila); disabled (Drosophila) homolog 1; disabled homolog 1; |
Gene ID | 1600 |
mRNA Refseq | NM_021080 |
Protein Refseq | NP_066566 |
MIM | 603448 |
UniProt ID | O75553 |
◆ Recombinant Proteins | ||
DAB1-2191M | Recombinant Mouse DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAB1-1425R | Recombinant Rat DAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAB1-447C | Recombinant Cynomolgus DAB1 Protein, His-tagged | +Inquiry |
Dab1-400R | Recombinant Rat Dab1 Protein, His-tagged | +Inquiry |
DAB1-1767R | Recombinant Rat DAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAB1-7087HCL | Recombinant Human DAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAB1 Products
Required fields are marked with *
My Review for All DAB1 Products
Required fields are marked with *
0
Inquiry Basket