Recombinant Full Length Human DAD1 Protein, GST-tagged
| Cat.No. : | DAD1-2314HF |
| Product Overview : | Human DAD1 full-length ORF ( AAH07403, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 113 amino acids |
| Description : | DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 38.17 kDa |
| AA Sequence : | MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAD1 defender against cell death 1 [ Homo sapiens ] |
| Official Symbol | DAD1 |
| Synonyms | DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1; |
| Gene ID | 1603 |
| mRNA Refseq | NM_001344 |
| Protein Refseq | NP_001335 |
| MIM | 600243 |
| UniProt ID | P61803 |
| ◆ Cell & Tissue Lysates | ||
| DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAD1 Products
Required fields are marked with *
My Review for All DAD1 Products
Required fields are marked with *



