Recombinant Full Length Human DAP Protein

• Cat.No.: DAP-121HF
• Product Overview: Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 102 amino acids
• Description: This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma.
• Form: Liquid
• Molecular Mass: 36.960kDa inclusive of tags
• AA Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: DAP death-associated protein [ Homo sapiens ]
• Official Symbol: DAP
• Synonyms: DAP; death-associated protein; death-associated protein 1
• Gene ID: 1611
• mRNA Refseq: NM_004394
• Protein Refseq: NP_004385
• MIM: 600954
• UniProt ID: P51397