Recombinant Full Length Human DAP Protein
| Cat.No. : | DAP-121HF |
| Product Overview : | Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
| Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 36.960kDa inclusive of tags |
| Protein Length : | 102 amino acids |
| AA Sequence : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | DAP death-associated protein [ Homo sapiens ] |
| Official Symbol : | DAP |
| Synonyms : | DAP; death-associated protein; death-associated protein 1 |
| Gene ID : | 1611 |
| mRNA Refseq : | NM_004394 |
| Protein Refseq : | NP_004385 |
| MIM : | 600954 |
| UniProt ID : | P51397 |
Products Types
| ◆ Recombinant Protein | ||
| DAP-892H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
| DAP-1432R | Recombinant Rat DAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dap-2449M | Recombinant Mouse Dap Protein, Myc/DDK-tagged | +Inquiry |
| Dap-1308R | Recombinant Rat Dap Protein, His-tagged | +Inquiry |
| DAP-2332H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
| ◆ Lysates | ||
| DAP-7078HCL | Recombinant Human DAP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
