Recombinant Full Length Human DAP Protein

Cat.No. : DAP-121HF
Product Overview : Recombinant full length Human DAP1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 102 amino acids
Description : This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma.
Form : Liquid
Molecular Mass : 36.960kDa inclusive of tags
AA Sequence : MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEK DKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQ KPHASMDKHPSPRTQHIQQPRK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name DAP death-associated protein [ Homo sapiens ]
Official Symbol DAP
Synonyms DAP; death-associated protein; death-associated protein 1
Gene ID 1611
mRNA Refseq NM_004394
Protein Refseq NP_004385
MIM 600954
UniProt ID P51397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAP Products

Required fields are marked with *

My Review for All DAP Products

Required fields are marked with *

0
cart-icon