Recombinant Full Length Human DAP Protein, GST-tagged
Cat.No. : | DAP-2381HF |
Product Overview : | Human DAP full-length ORF ( AAH02726, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 102 amino acids |
Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014] |
Molecular Mass : | 36.96 kDa |
AA Sequence : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAP death-associated protein [ Homo sapiens ] |
Official Symbol | DAP |
Synonyms | DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796; |
Gene ID | 1611 |
mRNA Refseq | NM_004394 |
Protein Refseq | NP_004385 |
MIM | 600954 |
UniProt ID | P51397 |
◆ Recombinant Proteins | ||
DAP-1000R | Recombinant Rhesus Macaque DAP Protein, His (Fc)-Avi-tagged | +Inquiry |
DAP-2684C | Recombinant Chicken DAP | +Inquiry |
DAP-41H | Recombinant Human DAP protein | +Inquiry |
DAP-2332H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
DAP-892H | Recombinant Human DAP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAP-7078HCL | Recombinant Human DAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAP Products
Required fields are marked with *
My Review for All DAP Products
Required fields are marked with *