Recombinant Full Length Human DAP Protein, GST-tagged
| Cat.No. : | DAP-2381HF |
| Product Overview : | Human DAP full-length ORF ( AAH02726, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 102 amino acids |
| Description : | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014] |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAP death-associated protein [ Homo sapiens ] |
| Official Symbol | DAP |
| Synonyms | DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796; |
| Gene ID | 1611 |
| mRNA Refseq | NM_004394 |
| Protein Refseq | NP_004385 |
| MIM | 600954 |
| UniProt ID | P51397 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAP Products
Required fields are marked with *
My Review for All DAP Products
Required fields are marked with *



