Recombinant Full Length Human DAP Protein, GST-tagged

Cat.No. : DAP-2381HF
Product Overview : Human DAP full-length ORF ( AAH02726, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 102 amino acids
Description : This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]
Molecular Mass : 36.96 kDa
AA Sequence : MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAP death-associated protein [ Homo sapiens ]
Official Symbol DAP
Synonyms DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796;
Gene ID 1611
mRNA Refseq NM_004394
Protein Refseq NP_004385
MIM 600954
UniProt ID P51397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAP Products

Required fields are marked with *

My Review for All DAP Products

Required fields are marked with *

0
cart-icon
0
compare icon