Recombinant Full Length Human DARS1 Protein, C-Flag-tagged
| Cat.No. : | DARS1-1036HFL |
| Product Overview : | Recombinant Full Length Human DARS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of a multienzyme complex that functions in mediating the attachment of amino acids to their cognate tRNAs. The encoded protein ligates L-aspartate to tRNA(Asp). Mutations in this gene have been found in patients showing hypomyelination with brainstem and spinal cord involvement and leg spasticity. Alternative splicing results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 57 kDa |
| AA Sequence : | MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSR AKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSCTQQDVELHVQ KIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETL INKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCE ALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTS MFPRDPKRLTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Aminoacyl-tRNA biosynthesis |
| Full Length : | Full L. |
| Gene Name | DARS1 aspartyl-tRNA synthetase 1 [ Homo sapiens (human) ] |
| Official Symbol | DARS1 |
| Synonyms | DARS; HBSL; aspRS |
| Gene ID | 1615 |
| mRNA Refseq | NM_001349.4 |
| Protein Refseq | NP_001340.2 |
| MIM | 603084 |
| UniProt ID | P14868 |
| ◆ Recombinant Proteins | ||
| DARS1-1036HFL | Recombinant Full Length Human DARS1 Protein, C-Flag-tagged | +Inquiry |
| DARS1-1921H | Recombinant Human DARS1 Protein (Gly363-Pro501), N-His tagged | +Inquiry |
| DARS1-715H | Recombinant Human DARS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DARS1 Products
Required fields are marked with *
My Review for All DARS1 Products
Required fields are marked with *



