Recombinant Full Length Human DARS2 Protein, C-Flag-tagged
Cat.No. : | DARS2-443HFL |
Product Overview : | Recombinant Full Length Human DARS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.4 kDa |
AA Sequence : | MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCG WIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIE IKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDI ETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQ IDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRN TEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPK EENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKED VKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH IRVSKPTDSKAERAHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Aminoacyl-tRNA biosynthesis |
Full Length : | Full L. |
Gene Name | DARS2 aspartyl-tRNA synthetase 2, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | DARS2 |
Synonyms | LBSL; ASPRS; mtAspRS; MT-ASPRS |
Gene ID | 55157 |
mRNA Refseq | NM_018122.5 |
Protein Refseq | NP_060592.2 |
MIM | 610956 |
UniProt ID | Q6PI48 |
◆ Recombinant Proteins | ||
DARS2-1776R | Recombinant Rat DARS2 Protein | +Inquiry |
DARS2-3673B | Recombinant Bovine DARS2, His-tagged | +Inquiry |
DARS2-2350H | Recombinant Human DARS2 Protein, GST-tagged | +Inquiry |
DARS2-2515HF | Recombinant Full Length Human DARS2 Protein, GST-tagged | +Inquiry |
DARS2-716H | Recombinant Human DARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DARS2-7072HCL | Recombinant Human DARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DARS2 Products
Required fields are marked with *
My Review for All DARS2 Products
Required fields are marked with *
0
Inquiry Basket