Recombinant Full Length Human DCANP1 Protein, GST-tagged
| Cat.No. : | DCANP1-2659HF |
| Product Overview : | Human DCANP1 full-length ORF (NP_570900.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 244 amino acids |
| Description : | This intronless gene is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleus. One of the alleles (A/T) of this gene, that causes premature translation termination at aa 117, has been associated with an increased prevalence of major depression in humans. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 53.1 kDa |
| AA Sequence : | MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCANP1 dendritic cell associated nuclear protein [ Homo sapiens (human) ] |
| Official Symbol | DCANP1 |
| Synonyms | DCANP1; dendritic cell associated nuclear protein; C5ORF20; chromosome 5 open reading frame 20; dendritic cell nuclear protein 1; DCNP1; |
| Gene ID | 140947 |
| mRNA Refseq | NM_130848 |
| Protein Refseq | NP_570900 |
| MIM | 609710 |
| UniProt ID | Q8TF63 |
| ◆ Recombinant Proteins | ||
| DCANP1-0082H | Recombinant Human DCANP1 Protein, GST-Tagged | +Inquiry |
| DCANP1-2659HF | Recombinant Full Length Human DCANP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCANP1 Products
Required fields are marked with *
My Review for All DCANP1 Products
Required fields are marked with *
