Recombinant Full Length Human DCTPP1 Protein, C-Flag-tagged

Cat.No. : DCTPP1-2046HFL
Product Overview : Recombinant Full Length Human DCTPP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 18.5 kDa
AA Sequence : MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK YTELPHGAISEDQAVGPADIPCDSTGQTST myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Stem cell - Pluripotency
Full Length : Full L.
Gene Name DCTPP1 dCTP pyrophosphatase 1 [ Homo sapiens (human) ]
Official Symbol DCTPP1
Synonyms CDA03; RS21C6; XTP3TPA
Gene ID 79077
mRNA Refseq NM_024096.2
Protein Refseq NP_077001.1
MIM 615840
UniProt ID Q9H773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCTPP1 Products

Required fields are marked with *

My Review for All DCTPP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon