Recombinant Full Length Human DCUN1D5 Protein, GST-tagged
Cat.No. : | DCUN1D5-2417HF |
Product Overview : | Human DCUN1D5 full-length ORF ( NP_115675.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 237 amino acids |
Description : | DCUN1D5 (Defective In Cullin Neddylation 1 Domain Containing 5) is a Protein Coding gene. An important paralog of this gene is DCUN1D4. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCUN1D5 DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D5 |
Synonyms | DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae); Defective in cullin neddylation protein 1-like protein 5; FLJ32431; MGC2714; DCN1-like protein 5; DCUN1D5 |
Gene ID | 84259 |
mRNA Refseq | NM_032299.3 |
Protein Refseq | NP_115675.1 |
MIM | 616522 |
UniProt ID | Q9BTE7 |
◆ Recombinant Proteins | ||
Dcun1d5-2486M | Recombinant Mouse Dcun1d5 Protein, Myc/DDK-tagged | +Inquiry |
DCUN1D5-4375M | Recombinant Mouse DCUN1D5 Protein | +Inquiry |
DCUN1D5-2247M | Recombinant Mouse DCUN1D5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCUN1D5-2417HF | Recombinant Full Length Human DCUN1D5 Protein, GST-tagged | +Inquiry |
DCUN1D5-1026R | Recombinant Rhesus Macaque DCUN1D5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCUN1D5-7033HCL | Recombinant Human DCUN1D5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D5 Products
Required fields are marked with *
My Review for All DCUN1D5 Products
Required fields are marked with *