Recombinant Full Length Human DCUN1D5 Protein, GST-tagged
| Cat.No. : | DCUN1D5-2417HF |
| Product Overview : | Human DCUN1D5 full-length ORF ( NP_115675.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 237 amino acids |
| Description : | DCUN1D5 (Defective In Cullin Neddylation 1 Domain Containing 5) is a Protein Coding gene. An important paralog of this gene is DCUN1D4. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCUN1D5 DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCUN1D5 |
| Synonyms | DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae); Defective in cullin neddylation protein 1-like protein 5; FLJ32431; MGC2714; DCN1-like protein 5; DCUN1D5 |
| Gene ID | 84259 |
| mRNA Refseq | NM_032299.3 |
| Protein Refseq | NP_115675.1 |
| MIM | 616522 |
| UniProt ID | Q9BTE7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCUN1D5 Products
Required fields are marked with *
My Review for All DCUN1D5 Products
Required fields are marked with *
