Recombinant Full Length Human DDRGK1 Protein, C-Flag-tagged
Cat.No. : | DDRGK1-2005HFL |
Product Overview : | Recombinant Full Length Human DDRGK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene interacts with components of the ubiquitin fold modifier 1 conjugation pathway and helps prevent apoptosis in ER-stressed secretory tissues. In addition, the encoded protein regulates nuclear factor-κB activity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDL GSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAKKLRKLEEKQARKAQREAEEA EREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKLKEAFVVEEEGVGETMTEE QSQSFLTEFINYIKQSKVVLLEDLASQVGLRTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVA NFIRQRGRVSIAELAQASNSLIAWGRESPAQAPA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | DDRGK1 DDRGK domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | DDRGK1 |
Synonyms | UFBP1; SEMDSH; C20orf116; dJ1187M17.3 |
Gene ID | 65992 |
mRNA Refseq | NM_023935.3 |
Protein Refseq | NP_076424.1 |
MIM | 616177 |
UniProt ID | Q96HY6 |
◆ Recombinant Proteins | ||
DDRGK1-737H | Recombinant Human DDRGK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDRGK1-1210R | Recombinant Rhesus monkey DDRGK1 Protein, His-tagged | +Inquiry |
DDRGK1-2005HFL | Recombinant Full Length Human DDRGK1 Protein, C-Flag-tagged | +Inquiry |
DDRGK1-2459H | Recombinant Human DDRGK1 Protein, GST-tagged | +Inquiry |
DDRGK1-5735H | Recombinant Human DDRGK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDRGK1-7023HCL | Recombinant Human DDRGK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDRGK1 Products
Required fields are marked with *
My Review for All DDRGK1 Products
Required fields are marked with *
0
Inquiry Basket