Recombinant Full Length Human DDT Protein, GST-tagged
| Cat.No. : | DDT-2505HF |
| Product Overview : | Human DDT full-length ORF ( AAH05971, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 118 amino acids |
| Description : | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DDT D-dopachrome tautomerase [ Homo sapiens ] |
| Official Symbol | DDT |
| Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842; |
| Gene ID | 1652 |
| mRNA Refseq | NM_001084392 |
| Protein Refseq | NP_001077861 |
| MIM | 602750 |
| UniProt ID | P30046 |
| ◆ Recombinant Proteins | ||
| DDT-1211R | Recombinant Rhesus monkey DDT Protein, His-tagged | +Inquiry |
| DDT-4396M | Recombinant Mouse DDT Protein | +Inquiry |
| DDT-1312C | Recombinant Cynomolgus DDT protein, His-tagged | +Inquiry |
| DDT-1473R | Recombinant Rat DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDT-8705HFL | Recombinant Full Length Human DDT, Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *
