Recombinant Full Length Human DDX19A Protein, GST-tagged

Cat.No. : DDX19A-2538HF
Product Overview : Human DDX19A full-length ORF ( NP_060802.1, 1 a.a. - 478 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 478 amino acids
Description : DDX19A (DEAD-Box Helicase 19A) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is ENSG00000260537.
Molecular Mass : 80.4 kDa
AA Sequence : MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDX19A DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A [ Homo sapiens ]
Official Symbol DDX19A
Synonyms DDX19A; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A; DDX19L, DEAD (Asp Glu Ala As) box polypeptide 19 like; ATP-dependent RNA helicase DDX19A; FLJ11126; RNA helicase; DDX19-like protein; DEAD box protein 19A; DEAD (Asp-Glu-Ala-As) box polypeptide 19A; DDX19L; DDX19-DDX19L; DKFZp686C21137;
Gene ID 55308
mRNA Refseq NM_018332
Protein Refseq NP_060802
UniProt ID Q9NUU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX19A Products

Required fields are marked with *

My Review for All DDX19A Products

Required fields are marked with *

0
cart-icon