Recombinant Full Length Human DDX19A Protein, GST-tagged
Cat.No. : | DDX19A-2538HF |
Product Overview : | Human DDX19A full-length ORF ( NP_060802.1, 1 a.a. - 478 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 478 amino acids |
Description : | DDX19A (DEAD-Box Helicase 19A) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is ENSG00000260537. |
Molecular Mass : | 80.4 kDa |
AA Sequence : | MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX19A DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A [ Homo sapiens ] |
Official Symbol | DDX19A |
Synonyms | DDX19A; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A; DDX19L, DEAD (Asp Glu Ala As) box polypeptide 19 like; ATP-dependent RNA helicase DDX19A; FLJ11126; RNA helicase; DDX19-like protein; DEAD box protein 19A; DEAD (Asp-Glu-Ala-As) box polypeptide 19A; DDX19L; DDX19-DDX19L; DKFZp686C21137; |
Gene ID | 55308 |
mRNA Refseq | NM_018332 |
Protein Refseq | NP_060802 |
UniProt ID | Q9NUU7 |
◆ Recombinant Proteins | ||
DDX19A-4929H | Recombinant Human DDX19A protein, His-SUMO-tagged | +Inquiry |
DDX19A-740H | Recombinant Human DDX19A Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX19A-5437H | Recombinant Human DDX19A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DDX19A-11892H | Recombinant Human DDX19A, GST-tagged | +Inquiry |
DDX19A-2538HF | Recombinant Full Length Human DDX19A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX19A-7018HCL | Recombinant Human DDX19A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX19A Products
Required fields are marked with *
My Review for All DDX19A Products
Required fields are marked with *