Recombinant Full Length Human DDX19A Protein, GST-tagged
| Cat.No. : | DDX19A-2538HF |
| Product Overview : | Human DDX19A full-length ORF ( NP_060802.1, 1 a.a. - 478 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 478 amino acids |
| Description : | DDX19A (DEAD-Box Helicase 19A) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is ENSG00000260537. |
| Molecular Mass : | 80.4 kDa |
| AA Sequence : | MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DDX19A DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A [ Homo sapiens ] |
| Official Symbol | DDX19A |
| Synonyms | DDX19A; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19A; DDX19L, DEAD (Asp Glu Ala As) box polypeptide 19 like; ATP-dependent RNA helicase DDX19A; FLJ11126; RNA helicase; DDX19-like protein; DEAD box protein 19A; DEAD (Asp-Glu-Ala-As) box polypeptide 19A; DDX19L; DDX19-DDX19L; DKFZp686C21137; |
| Gene ID | 55308 |
| mRNA Refseq | NM_018332 |
| Protein Refseq | NP_060802 |
| UniProt ID | Q9NUU7 |
| ◆ Recombinant Proteins | ||
| DDX19A-2469H | Recombinant Human DDX19A Protein, GST-tagged | +Inquiry |
| DDX19A-4402M | Recombinant Mouse DDX19A Protein | +Inquiry |
| DDX19A-740H | Recombinant Human DDX19A Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX19A-2265M | Recombinant Mouse DDX19A Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX19A-2538HF | Recombinant Full Length Human DDX19A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX19A-7018HCL | Recombinant Human DDX19A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX19A Products
Required fields are marked with *
My Review for All DDX19A Products
Required fields are marked with *
