Recombinant Full Length Human DDX19B Protein, GST-tagged
| Cat.No. : | DDX19B-2537HF |
| Product Overview : | Human DDX19 full-length ORF ( AAH03626, 1 a.a. - 479 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 479 amino acids |
| Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 78.43 kDa |
| AA Sequence : | MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DDX19B DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B [ Homo sapiens ] |
| Official Symbol | DDX19B |
| Synonyms | DDX19B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B; DDX19, DEAD (Asp Glu Ala As) box polypeptide 19 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); ATP-dependent RNA helicase DDX19B; DBP5; DEAD-box protein 5; yeast Dbp5 homolog; DEAD box protein 19B; DEAD box RNA helicase DEAD5; DEAD-box RNA helicase DEAD5; ATP-dependent RNA helicase DDX19; DEAD (Asp-Glu-Ala-As) box polypeptide 19B; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); RNAh; DDX19; |
| Gene ID | 11269 |
| mRNA Refseq | NM_001014449 |
| Protein Refseq | NP_001014449 |
| MIM | 605812 |
| UniProt ID | Q9UMR2 |
| ◆ Recombinant Proteins | ||
| DDX19B-201C | Recombinant Cynomolgus Monkey DDX19B Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX19B-5323H | Recombinant Human DDX19B protein, His&Myc-tagged | +Inquiry |
| DDX19B-11893H | Recombinant Human DDX19B, His-tagged | +Inquiry |
| DDX19B-1705C | Recombinant Chicken DDX19B | +Inquiry |
| DDX19B-8544H | Recombinant Human DDX19B protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX19B-7017HCL | Recombinant Human DDX19B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX19B Products
Required fields are marked with *
My Review for All DDX19B Products
Required fields are marked with *
