Recombinant Full Length Human DDX39A Protein, GST-tagged
Cat.No. : | DDX39A-3775HF |
Product Overview : | Human DDX39 full-length ORF ( NP_005795.2, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 427 amino acids |
Description : | This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 75.5 kDa |
AA Sequence : | MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX39A DExD-box helicase 39A [ Homo sapiens (human) ] |
Official Symbol | DDX39A |
Synonyms | DDX39; DDX39A; DExD-box helicase 39A; BAT1; DDXL; BAT1L; URH49; ATP-dependent RNA helicase DDX39A; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A; DEAD box protein 39; DEAD-box helicase 39A; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39; UAP56-related helicase, 49 kDa; nuclear RNA helicase URH49; nuclear RNA helicase, DECD variant of DEAD box family; EC 3.6.4.13 |
Gene ID | 10212 |
mRNA Refseq | NM_005804 |
Protein Refseq | NP_005795 |
MIM | 619906 |
UniProt ID | O00148 |
◆ Recombinant Proteins | ||
Ddx39a-2504M | Recombinant Mouse Ddx39a Protein, Myc/DDK-tagged | +Inquiry |
DDX39A-3750H | Recombinant Human DDX39A, His-tagged | +Inquiry |
DDX39A-1215R | Recombinant Rhesus monkey DDX39A Protein, His-tagged | +Inquiry |
DDX39A-1477R | Recombinant Rat DDX39A Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX39A-5140H | Recombinant Human DDX39A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX39A-7008HCL | Recombinant Human DDX39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX39A Products
Required fields are marked with *
My Review for All DDX39A Products
Required fields are marked with *