Recombinant Full Length Human DEFB135 Protein, GST-tagged

• Cat.No.: DEFB135-3922HF
• Product Overview: Human DEFB136 full-length ORF (AAI46564.1, 1 a.a. - 77 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 77 amino acids
• Description: Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 8p23. [provided by RefSeq, Nov 2014]
• Molecular Mass: 35.42 kDa
• AA Sequence: MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB135 defensin beta 135 [ Homo sapiens (human) ]
• Official Symbol: DEFB135
• Synonyms: DEFB136; DEFB135; defensin beta 135; beta-defensin 135; beta-defensin 136
• Gene ID: 613209
• mRNA Refseq: NM_001033017
• Protein Refseq: NP_001028189
• UniProt ID: Q30KP9