Recombinant Full Length Human DEFB4A Protein, GST-tagged
| Cat.No. : | DEFB4A-3752HF |
| Product Overview : | Human DEFB4 full-length ORF ( NP_004933.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 64 amino acids |
| Description : | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 33.4 kDa |
| AA Sequence : | MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DEFB4A defensin beta 4A [ Homo sapiens (human) ] |
| Official Symbol | DEFB4A |
| Synonyms | DEFB4; DEFB4A; defensin beta 4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; beta-defensin 4A; beta defensin-2; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1 |
| Gene ID | 1673 |
| mRNA Refseq | NM_004942 |
| Protein Refseq | NP_004933 |
| MIM | 602215 |
| UniProt ID | O15263 |
| ◆ Recombinant Proteins | ||
| DEFB4A-133D | Active Recombinant Human DEFB4A Protein (50 aa) | +Inquiry |
| DEFB4A-5190H | Recombinant Human Defensin, Beta 4A | +Inquiry |
| DEFB4A-5133H | Recombinant Human DEFB4A Protein, GST-tagged | +Inquiry |
| DEFB4A-1239R | Recombinant Rhesus monkey DEFB4A Protein, His-tagged | +Inquiry |
| DEFB4A-1948H | Recombinant Human DEFB4A Protein (Gly24-Pro64), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB4A Products
Required fields are marked with *
My Review for All DEFB4A Products
Required fields are marked with *
