Recombinant Full Length Human DEPDC7 Protein, GST-tagged

• Cat.No.: DEPDC7-5941HF
• Product Overview: Human LOC91614 full-length ORF ( AAH30970.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 511 amino acids
• Description: DEPDC7 (DEP Domain Containing 7) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by Rho GTPases. An important paralog of this gene is DEPDC1B.
• Molecular Mass: 84.7 kDa
• AA Sequence: MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEPDC7 DEP domain containing 7 [ Homo sapiens ]
• Official Symbol: DEPDC7
• Synonyms: DEPDC7; DEP domain containing 7; DEP domain-containing protein 7; novel 58.3 KDA protein; dJ85M6.4 (novel 58.3 KDA protein); TR2; dJ85M6.4
• Gene ID: 91614
• mRNA Refseq: NM_001077242
• Protein Refseq: NP_001070710
• MIM: 612294
• UniProt ID: Q96QD5