Recombinant Full Length Human DEPTOR Protein, C-Flag-tagged
| Cat.No. : | DEPTOR-957HFL |
| Product Overview : | Recombinant Full Length Human DEPTOR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Involved in several processes, including negative regulation of TOR signaling; negative regulation of cell size; and negative regulation of protein kinase activity. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 46.1 kDa |
| AA Sequence : | MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSSKHPFVD SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELECTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | DEPTOR DEP domain containing MTOR interacting protein [ Homo sapiens (human) ] |
| Official Symbol | DEPTOR |
| Synonyms | DEP.6; DEPDC6 |
| Gene ID | 64798 |
| mRNA Refseq | NM_022783.4 |
| Protein Refseq | NP_073620.2 |
| MIM | 612974 |
| UniProt ID | Q8TB45 |
| ◆ Recombinant Proteins | ||
| DEPTOR-4124H | Recombinant Human DEPTOR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DEPTOR-749H | Recombinant Human DEPTOR Protein, His (Fc)-Avi-tagged | +Inquiry |
| Deptor-2528M | Recombinant Mouse Deptor Protein, Myc/DDK-tagged | +Inquiry |
| DEPTOR-3848HF | Recombinant Full Length Human DEPTOR Protein, GST-tagged | +Inquiry |
| DEPTOR-957HFL | Recombinant Full Length Human DEPTOR Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEPTOR Products
Required fields are marked with *
My Review for All DEPTOR Products
Required fields are marked with *
