Recombinant Full Length Human DEPTOR Protein, C-Flag-tagged
Cat.No. : | DEPTOR-957HFL |
Product Overview : | Recombinant Full Length Human DEPTOR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in several processes, including negative regulation of TOR signaling; negative regulation of cell size; and negative regulation of protein kinase activity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSSKHPFVD SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELECTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DEPTOR DEP domain containing MTOR interacting protein [ Homo sapiens (human) ] |
Official Symbol | DEPTOR |
Synonyms | DEP.6; DEPDC6 |
Gene ID | 64798 |
mRNA Refseq | NM_022783.4 |
Protein Refseq | NP_073620.2 |
MIM | 612974 |
UniProt ID | Q8TB45 |
◆ Recombinant Proteins | ||
DEPTOR-4681Z | Recombinant Zebrafish DEPTOR | +Inquiry |
DEPTOR-3848HF | Recombinant Full Length Human DEPTOR Protein, GST-tagged | +Inquiry |
DEPTOR-4124H | Recombinant Human DEPTOR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEPTOR-5182H | Recombinant Human DEPTOR Protein, GST-tagged | +Inquiry |
DEPTOR-749H | Recombinant Human DEPTOR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEPTOR Products
Required fields are marked with *
My Review for All DEPTOR Products
Required fields are marked with *