Recombinant Full Length Human DEXI Protein, GST-tagged

Cat.No. : DEXI-2478HF
Product Overview : Human DEXI full-length ORF ( AAH01083, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 95 amino acids
Description : DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome.
Molecular Mass : 36.19 kDa
AA Sequence : MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEXI Dexi homolog (mouse) [ Homo sapiens ]
Official Symbol DEXI
Synonyms MYLE
Gene ID 28955
mRNA Refseq NM_014015.3
Protein Refseq NP_054734.2
MIM 617901
UniProt ID O95424

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEXI Products

Required fields are marked with *

My Review for All DEXI Products

Required fields are marked with *

0
cart-icon