Recombinant Full Length Human DEXI Protein, GST-tagged
| Cat.No. : | DEXI-2478HF |
| Product Overview : | Human DEXI full-length ORF ( AAH01083, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 95 amino acids |
| Description : | DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome. |
| Molecular Mass : | 36.19 kDa |
| AA Sequence : | MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DEXI Dexi homolog (mouse) [ Homo sapiens ] |
| Official Symbol | DEXI |
| Synonyms | MYLE |
| Gene ID | 28955 |
| mRNA Refseq | NM_014015.3 |
| Protein Refseq | NP_054734.2 |
| MIM | 617901 |
| UniProt ID | O95424 |
| ◆ Recombinant Proteins | ||
| DEXI-2553H | Recombinant Human DEXI Protein, GST-tagged | +Inquiry |
| DEXI-1248R | Recombinant Rhesus monkey DEXI Protein, His-tagged | +Inquiry |
| DEXI-4530M | Recombinant Mouse DEXI Protein | +Inquiry |
| DEXI-938H | Recombinant Human DEXI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DEXI-2340M | Recombinant Mouse DEXI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEXI-6968HCL | Recombinant Human DEXI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEXI Products
Required fields are marked with *
My Review for All DEXI Products
Required fields are marked with *
