Recombinant Full Length Human DGKA Protein, GST-tagged
| Cat.No. : | DGKA-2496HF |
| Product Overview : | Human DGKA full-length ORF ( AAH31870, 1 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 735 amino acids |
| Description : | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017] |
| Molecular Mass : | 106.37 kDa |
| AA Sequence : | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFYIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWVQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DGKA diacylglycerol kinase, alpha 80kDa [ Homo sapiens ] |
| Official Symbol | DGKA |
| Synonyms | DGKA; diacylglycerol kinase, alpha 80kDa; DAGK, DAGK1, diacylglycerol kinase, alpha (80kD); diacylglycerol kinase alpha; DGK alpha; DAG kinase alpha; diglyceride kinase alpha; 80 kDa diacylglycerol kinase; DAGK; DAGK1; DGK-alpha; MGC12821; MGC42356; |
| Gene ID | 1606 |
| mRNA Refseq | NM_001345 |
| Protein Refseq | NP_001336 |
| MIM | 125855 |
| UniProt ID | P23743 |
| ◆ Recombinant Proteins | ||
| DGKA-4712H | Recombinant Human DGKA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DGKA-1044B | Recombinant Bacillus subtilis DGKA protein, His-tagged | +Inquiry |
| DGKA-1854R | Recombinant Rat DGKA Protein | +Inquiry |
| DGKA-1056H | Recombinant Human DGKA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DGKA-751H | Recombinant Human DGKA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGKA-6961HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
| DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKA Products
Required fields are marked with *
My Review for All DGKA Products
Required fields are marked with *
