Recombinant Full Length Human DHRS1 Protein, GST-tagged
| Cat.No. : | DHRS1-2534HF |
| Product Overview : | Human DHRS1 full-length ORF ( NP_612461.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 313 amino acids |
| Description : | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
| Molecular Mass : | 60.3 kDa |
| AA Sequence : | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DHRS1 dehydrogenase/reductase (SDR family) member 1 [ Homo sapiens ] |
| Official Symbol | DHRS1 |
| Synonyms | DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523; |
| Gene ID | 115817 |
| mRNA Refseq | NM_138452 |
| Protein Refseq | NP_612461 |
| MIM | 610410 |
| UniProt ID | Q96LJ7 |
| ◆ Recombinant Proteins | ||
| Dhrs1-2548M | Recombinant Mouse Dhrs1 Protein, Myc/DDK-tagged | +Inquiry |
| DHRS1-5328H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DHRS1-2593H | Recombinant Human DHRS1 Protein, GST-tagged | +Inquiry |
| DHRS1-4509H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DHRS1-422Z | Recombinant Zebrafish DHRS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS1 Products
Required fields are marked with *
My Review for All DHRS1 Products
Required fields are marked with *
