Recombinant Full Length Human DHRS4L2 Protein, GST-tagged
| Cat.No. : | DHRS4L2-2540HF |
| Product Overview : | Human DHRS4L2 full-length ORF ( NP_932349.1, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 230 amino acids |
| Description : | This gene encodes a member of the short chain dehydrogenase reductase family. The encoded protein may be an NADPH dependent retinol oxidoreductase. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
| Molecular Mass : | 51 kDa |
| AA Sequence : | MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DHRS4L2 dehydrogenase/reductase (SDR family) member 4 like 2 [ Homo sapiens ] |
| Official Symbol | DHRS4L2 |
| Synonyms | DHRS4L2; dehydrogenase/reductase (SDR family) member 4 like 2; dehydrogenase/reductase SDR family member 4-like 2; SDR25C3; short chain dehydrogenase/reductase family 25C; member 3; dehydrogenase/reductase (SDR family) member 4 like 2A3; short chain dehydrogenase/reductase family 25C, member 3; MGC905; FLJ11525; |
| Gene ID | 317749 |
| mRNA Refseq | NM_001193635 |
| Protein Refseq | NP_001180564 |
| MIM | 615196 |
| UniProt ID | Q6PKH6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS4L2 Products
Required fields are marked with *
My Review for All DHRS4L2 Products
Required fields are marked with *




