Recombinant Full Length Human DHRSX Protein, GST-tagged
| Cat.No. : | DHRSX-2549HF |
| Product Overview : | Human DHRSX full-length ORF ( NP_660160.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 330 amino acids |
| Description : | DHRSX (Dehydrogenase/Reductase X-Linked) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH14. |
| Molecular Mass : | 62.9 kDa |
| AA Sequence : | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DHRSX dehydrogenase/reductase (SDR family) X-linked [ Homo sapiens ] |
| Official Symbol | DHRSX |
| Synonyms | DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11; |
| Gene ID | 207063 |
| mRNA Refseq | NM_145177 |
| Protein Refseq | NP_660160 |
| MIM | 301034 |
| UniProt ID | Q8N5I4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRSX Products
Required fields are marked with *
My Review for All DHRSX Products
Required fields are marked with *



