Recombinant Full Length Human DHRSX Protein, GST-tagged
Cat.No. : | DHRSX-2549HF |
Product Overview : | Human DHRSX full-length ORF ( NP_660160.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 330 amino acids |
Description : | DHRSX (Dehydrogenase/Reductase X-Linked) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH14. |
Molecular Mass : | 62.9 kDa |
AA Sequence : | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHRSX dehydrogenase/reductase (SDR family) X-linked [ Homo sapiens ] |
Official Symbol | DHRSX |
Synonyms | DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11; |
Gene ID | 207063 |
mRNA Refseq | NM_145177 |
Protein Refseq | NP_660160 |
MIM | 301034 |
UniProt ID | Q8N5I4 |
◆ Recombinant Proteins | ||
DHRSX-6743H | Recombinant Human DHRSX protein, His-tagged | +Inquiry |
DHRSX-757H | Recombinant Human DHRSX Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRSX-1749HFL | Recombinant Full Length Human DHRSX Protein, C-Flag-tagged | +Inquiry |
DHRSX-11980H | Recombinant Human DHRSX protein, GST-tagged | +Inquiry |
DHRSX-6317H | Recombinant Human DHRSX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRSX-474HCL | Recombinant Human DHRSX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRSX Products
Required fields are marked with *
My Review for All DHRSX Products
Required fields are marked with *