Recombinant Full Length Human DIO1 Protein, GST-tagged
| Cat.No. : | DIO1-2559HF |
| Product Overview : | Human DIO1 full-length ORF ( NP_998758.1, 1 a.a. - 61 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 61 amino acids |
| Description : | The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the activation, as well as the inactivation of thyroid hormone by outer and inner ring deiodination, respectively. The activation reaction involves the conversion of the prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4), secreted by the thyroid gland, to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by 5'-deiodination. This protein is expressed predominantly in the liver and kidney and provides most of the circulating T3, which is essential for growth, differentiation and basal metabolism in vertebrates. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2016] |
| Molecular Mass : | 33.2 kDa |
| AA Sequence : | MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGNRPLVLNFGSCT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DIO1 deiodinase, iodothyronine, type I [ Homo sapiens ] |
| Official Symbol | DIO1 |
| Synonyms | DIO1; deiodinase, iodothyronine, type I; TXDI1; type I iodothyronine deiodinase; DIOI; type 1 DI; type-I 5-deiodinase; thyroxine deiodinase type I (selenoprotein); 5DI; MGC130050; MGC130051; |
| Gene ID | 1733 |
| mRNA Refseq | NM_000792 |
| Protein Refseq | NP_000783 |
| MIM | 147892 |
| UniProt ID | P49895 |
| ◆ Recombinant Proteins | ||
| RFL28520OF | Recombinant Full Length Rabbit Type I Iodothyronine Deiodinase(Dio1) Protein, His-Tagged | +Inquiry |
| Dio1-1339R | Recombinant Rat Dio1 Protein, His-tagged | +Inquiry |
| RFL18067CF | Recombinant Full Length Dog Type I Iodothyronine Deiodinase(Dio1) Protein, His-Tagged | +Inquiry |
| DIO1-2378M | Recombinant Mouse DIO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIO1-4594M | Recombinant Mouse DIO1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIO1 Products
Required fields are marked with *
My Review for All DIO1 Products
Required fields are marked with *
