Recombinant Full Length Human DIO1 Protein, GST-tagged

Cat.No. : DIO1-2559HF
Product Overview : Human DIO1 full-length ORF ( NP_998758.1, 1 a.a. - 61 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 61 amino acids
Description : The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the activation, as well as the inactivation of thyroid hormone by outer and inner ring deiodination, respectively. The activation reaction involves the conversion of the prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4), secreted by the thyroid gland, to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by 5'-deiodination. This protein is expressed predominantly in the liver and kidney and provides most of the circulating T3, which is essential for growth, differentiation and basal metabolism in vertebrates. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2016]
Molecular Mass : 33.2 kDa
AA Sequence : MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGNRPLVLNFGSCT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIO1 deiodinase, iodothyronine, type I [ Homo sapiens ]
Official Symbol DIO1
Synonyms DIO1; deiodinase, iodothyronine, type I; TXDI1; type I iodothyronine deiodinase; DIOI; type 1 DI; type-I 5-deiodinase; thyroxine deiodinase type I (selenoprotein); 5DI; MGC130050; MGC130051;
Gene ID 1733
mRNA Refseq NM_000792
Protein Refseq NP_000783
MIM 147892
UniProt ID P49895

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIO1 Products

Required fields are marked with *

My Review for All DIO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon