Recombinant Full Length Human DLK1 Protein, GST-tagged
Cat.No. : | DLK1-3992HF |
Product Overview : | Human DLK1 full-length ORF ( AAH07741.1, 25 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 25-383 amino acids |
Description : | This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is located in a region of chromosome 14 frequently showing unparental disomy, and is imprinted and expressed from the paternal allele. A single nucleotide variant in this gene is associated with child and adolescent obesity and shows polar overdominance, where heterozygotes carrying an active paternal allele express the phenotype, while mutant homozygotes are normal. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 65.23 kDa |
AA Sequence : | ECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSRAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | DLK1 |
Synonyms | DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1; |
Gene ID | 8788 |
mRNA Refseq | NM_003836 |
Protein Refseq | NP_003827 |
MIM | 176290 |
UniProt ID | P80370 |
◆ Recombinant Proteins | ||
DLK1-188H | Recombinant Human DLK1 protein, His-tagged | +Inquiry |
DLK1-1347H | Recombinant Human DLK1 Protein, His&GST-tagged | +Inquiry |
DLK1-583H | Active Recombinant Human DLK1 protein, hFc-tagged | +Inquiry |
DLK1-3124H | Recombinant Human DLK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DLK1-2820H | Recombinant Human DLK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK1-6909HCL | Recombinant Human DLK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK1 Products
Required fields are marked with *
My Review for All DLK1 Products
Required fields are marked with *