Recombinant Full Length Human DLX6 Protein, GST-tagged
Cat.No. : | DLX6-4007HF |
Product Overview : | Human DLX6 full-length ORF ( AAH69363.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 175 amino acids |
Description : | This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLX6 distal-less homeobox 6 [ Homo sapiens ] |
Official Symbol | DLX6 |
Synonyms | DLX6; distal-less homeobox 6; distal less homeo box 6; homeobox protein DLX-6; distal-less homeo box 6; MGC125282; MGC125283; MGC125284; MGC125285; |
Gene ID | 1750 |
mRNA Refseq | NM_005222 |
Protein Refseq | NP_005213 |
MIM | 600030 |
UniProt ID | P56179 |
◆ Recombinant Proteins | ||
Dlx6-4892M | Recombinant Mouse Dlx6 protein | +Inquiry |
DLX6-2697H | Recombinant Human DLX6 Protein, GST-tagged | +Inquiry |
Dlx6-4888M | Recombinant Mouse Dlx6 protein | +Inquiry |
DLX6-301124H | Recombinant Human DLX6 protein, GST-tagged | +Inquiry |
DLX6-3645C | Recombinant Chicken DLX6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX6-486HCL | Recombinant Human DLX6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLX6 Products
Required fields are marked with *
My Review for All DLX6 Products
Required fields are marked with *