Recombinant Full Length Human DNAJC15 Protein, GST-tagged

Cat.No. : DNAJC15-3997HF
Product Overview : Human DNAJD1 full-length ORF ( AAH10910, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 150 amino acids
Description : DNAJC15 (DnaJ Heat Shock Protein Family (Hsp40) Member C15) is a Protein Coding gene. Diseases associated with DNAJC15 include Cicatricial Entropion. An important paralog of this gene is DNAJC19.
Molecular Mass : 42.24 kDa
AA Sequence : MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC15 DnaJ (Hsp40) homolog, subfamily C, member 15 [ Homo sapiens ]
Official Symbol DNAJC15
Synonyms DNAJC15; DnaJ (Hsp40) homolog, subfamily C, member 15; DnaJ (Hsp40) homolog, subfamily D, member 1 , DNAJD1; dnaJ homolog subfamily C member 15; MCJ; DNAJ domain-containing; methylation-controlled J protein; cell growth-inhibiting gene 22 protein; DnaJ (Hsp40) homolog, subfamily D, member 1; HSD18; DNAJD1;
Gene ID 29103
mRNA Refseq NM_013238
Protein Refseq NP_037370
MIM 615339
UniProt ID Q9Y5T4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC15 Products

Required fields are marked with *

My Review for All DNAJC15 Products

Required fields are marked with *

0
cart-icon