Recombinant Full Length Human DNAJC24 Protein, GST-tagged
Cat.No. : | DNAJC24-4011HF |
Product Overview : | Human DNAJC24 full-length ORF (1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 148 amino acids |
Description : | Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 42.68 kDa |
AA Sequence : | MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC24 DnaJ (Hsp40) homolog, subfamily C, member 24 [ Homo sapiens ] |
Official Symbol | DNAJC24 |
Synonyms | DNAJC24; DnaJ (Hsp40) homolog, subfamily C, member 24; DPH4, DPH4 homolog (JJJ3, S. cerevisiae) , DPH4, JJJ3 homolog (S. cerevisiae) , ZCSL3, zinc finger, CSL type containing 3; dnaJ homolog subfamily C member 24; JJJ3; 1700030A21Rik; DPH4, JJJ3 homolog; DPH4 homolog (JJJ3, S. cerevisiae); zinc finger, CSL-type containing 3; zinc finger, CSL domain containing 3; CSL-type zinc finger-containing protein 3; DPH4; ZCSL3; |
Gene ID | 120526 |
mRNA Refseq | NM_181706 |
Protein Refseq | NP_859057 |
MIM | 611072 |
UniProt ID | Q6P3W2 |
◆ Recombinant Proteins | ||
DNAJC24-10756Z | Recombinant Zebrafish DNAJC24 | +Inquiry |
DNAJC24-2758H | Recombinant Human DNAJC24 Protein, GST-tagged | +Inquiry |
Dnajc24-2608M | Recombinant Mouse Dnajc24 Protein, Myc/DDK-tagged | +Inquiry |
DNAJC24-7600H | Recombinant Human DNAJC24, His-tagged | +Inquiry |
DNAJC24-6289H | Recombinant Human DNAJC24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC24-6874HCL | Recombinant Human DNAJC24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC24 Products
Required fields are marked with *
My Review for All DNAJC24 Products
Required fields are marked with *