Recombinant Full Length Human DNAJC24 Protein, GST-tagged

Cat.No. : DNAJC24-4011HF
Product Overview : Human DNAJC24 full-length ORF (1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 148 amino acids
Description : Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM, Mar 2008]
Molecular Mass : 42.68 kDa
AA Sequence : MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC24 DnaJ (Hsp40) homolog, subfamily C, member 24 [ Homo sapiens ]
Official Symbol DNAJC24
Synonyms DNAJC24; DnaJ (Hsp40) homolog, subfamily C, member 24; DPH4, DPH4 homolog (JJJ3, S. cerevisiae) , DPH4, JJJ3 homolog (S. cerevisiae) , ZCSL3, zinc finger, CSL type containing 3; dnaJ homolog subfamily C member 24; JJJ3; 1700030A21Rik; DPH4, JJJ3 homolog; DPH4 homolog (JJJ3, S. cerevisiae); zinc finger, CSL-type containing 3; zinc finger, CSL domain containing 3; CSL-type zinc finger-containing protein 3; DPH4; ZCSL3;
Gene ID 120526
mRNA Refseq NM_181706
Protein Refseq NP_859057
MIM 611072
UniProt ID Q6P3W2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC24 Products

Required fields are marked with *

My Review for All DNAJC24 Products

Required fields are marked with *

0
cart-icon