Recombinant Full Length Human DNAJC4 Protein, GST-tagged
Cat.No. : | DNAJC4-4019HF |
Product Overview : | Human DNAJC4 full-length ORF (AAH44584.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 241 amino acids |
Description : | DNAJC4 (DnaJ Heat Shock Protein Family (Hsp40) Member C4) is a Protein Coding gene. GO annotations related to this gene include unfolded protein binding. |
Molecular Mass : | 52.91 kDa |
AA Sequence : | MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC4 DnaJ (Hsp40) homolog, subfamily C, member 4 [ Homo sapiens ] |
Official Symbol | DNAJC4 |
Synonyms | DNAJC4; DnaJ (Hsp40) homolog, subfamily C, member 4; HSPF2; MCG18; DANJC4 |
Gene ID | 3338 |
mRNA Refseq | NM_005528 |
Protein Refseq | NP_005519 |
MIM | 604189 |
UniProt ID | Q9NNZ3 |
◆ Recombinant Proteins | ||
DNAJC4-4019HF | Recombinant Full Length Human DNAJC4 Protein, GST-tagged | +Inquiry |
DNAJC4-1123R | Recombinant Rhesus Macaque DNAJC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33062MF | Recombinant Full Length Mouse Dnaj Homolog Subfamily C Member 4(Dnajc4) Protein, His-Tagged | +Inquiry |
DNAJC4-4716M | Recombinant Mouse DNAJC4 Protein | +Inquiry |
DNAJC4-399H | Recombinant Human DNAJC4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC4 Products
Required fields are marked with *
My Review for All DNAJC4 Products
Required fields are marked with *
0
Inquiry Basket