Recombinant Full Length Human DNAJC5B Protein, GST-tagged

Cat.No. : DNAJC5B-4021HF
Product Overview : Human DNAJC5B full-length ORF ( NP_149096.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 199 amino acids
Description : This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017]
Molecular Mass : 48.9 kDa
AA Sequence : MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC5B DnaJ (Hsp40) homolog, subfamily C, member 5 beta [ Homo sapiens ]
Official Symbol DNAJC5B
Synonyms DNAJC5B; DnaJ (Hsp40) homolog, subfamily C, member 5 beta; dnaJ homolog subfamily C member 5B; CSP beta; MGC26226; beta-CSP; beta cysteine string protein; cysteine string protein beta; dnaJ homolog subfamily C member X; CSP-beta;
Gene ID 85479
mRNA Refseq NM_033105
Protein Refseq NP_149096
MIM 613945
UniProt ID Q9UF47

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC5B Products

Required fields are marked with *

My Review for All DNAJC5B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon