Recombinant Full Length Human DNAJC5B Protein, GST-tagged

• Cat.No.: DNAJC5B-4021HF
• Product Overview: Human DNAJC5B full-length ORF ( NP_149096.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 199 amino acids
• Description: This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017]
• Molecular Mass: 48.9 kDa
• AA Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC5B DnaJ (Hsp40) homolog, subfamily C, member 5 beta [ Homo sapiens ]
• Official Symbol: DNAJC5B
• Synonyms: DNAJC5B; DnaJ (Hsp40) homolog, subfamily C, member 5 beta; dnaJ homolog subfamily C member 5B; CSP beta; MGC26226; beta-CSP; beta cysteine string protein; cysteine string protein beta; dnaJ homolog subfamily C member X; CSP-beta
• Gene ID: 85479
• mRNA Refseq: NM_033105
• Protein Refseq: NP_149096
• MIM: 613945
• UniProt ID: Q9UF47