Recombinant Full Length Human DNASE1L2 Protein, GST-tagged
| Cat.No. : | DNASE1L2-4034HF |
| Product Overview : | Human DNASE1L2 full-length ORF (BAG53566.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 299 amino acids |
| Description : | DNASE1L2 (Deoxyribonuclease 1 Like 2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and deoxyribonuclease activity. An important paralog of this gene is DNASE1. |
| Molecular Mass : | 59.3 kDa |
| AA Sequence : | MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNASE1L2 deoxyribonuclease I-like 2 [ Homo sapiens ] |
| Official Symbol | DNASE1L2 |
| Synonyms | DNAS1L2 |
| Gene ID | 1775 |
| mRNA Refseq | NM_001374 |
| Protein Refseq | NP_001365 |
| MIM | 602622 |
| UniProt ID | Q92874 |
| ◆ Recombinant Proteins | ||
| Dnase1l2-192R | Recombinant Rat Dnase1l2 Protein, His-tagged | +Inquiry |
| Dnase1l2-191M | Recombinant Mouse Dnase1l2 Protein, His-tagged | +Inquiry |
| DNASE1L2-2463M | Recombinant Mouse DNASE1L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DNASE1L2-4728M | Recombinant Mouse DNASE1L2 Protein | +Inquiry |
| DNASE1L2-12096H | Recombinant Human DNASE1L2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNASE1L2-229HCL | Recombinant Human DNASE1L2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L2 Products
Required fields are marked with *
My Review for All DNASE1L2 Products
Required fields are marked with *
