Recombinant Full Length Human Dolichol Phosphate-Mannose Biosynthesis Regulatory Protein(Dpm2) Protein, His-Tagged
| Cat.No. : | RFL7766HF |
| Product Overview : | Recombinant Full Length Human Dolichol phosphate-mannose biosynthesis regulatory protein(DPM2) Protein (O94777) (2-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-84) |
| Form : | Lyophilized powder |
| AA Sequence : | ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLL LLFVGLFISYVMLKTKRVTKKAQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | DPM2 |
| Synonyms | DPM2; My026; Dolichol phosphate-mannose biosynthesis regulatory protein; Dolichol-phosphate mannose synthase subunit 2; DPM synthase subunit 2 |
| UniProt ID | O94777 |
| ◆ Recombinant Proteins | ||
| RFL7766HF | Recombinant Full Length Human Dolichol Phosphate-Mannose Biosynthesis Regulatory Protein(Dpm2) Protein, His-Tagged | +Inquiry |
| DPM2-2815H | Recombinant Human DPM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dpm2-2638M | Recombinant Mouse Dpm2 Protein, Myc/DDK-tagged | +Inquiry |
| DPM2-1146R | Recombinant Rhesus Macaque DPM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DPM2-1940R | Recombinant Rat DPM2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPM2-6834HCL | Recombinant Human DPM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPM2 Products
Required fields are marked with *
My Review for All DPM2 Products
Required fields are marked with *
