Recombinant Full Length Human DPT Protein, C-Flag-tagged
Cat.No. : | DPT-1754HFL |
Product Overview : | Recombinant Full Length Human DPT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP YSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | DPT dermatopontin [ Homo sapiens (human) ] |
Official Symbol | DPT |
Synonyms | TRAMP |
Gene ID | 1805 |
mRNA Refseq | NM_001937.5 |
Protein Refseq | NP_001928.2 |
MIM | 125597 |
UniProt ID | Q07507 |
◆ Recombinant Proteins | ||
Dpt-2511M | Recombinant Mouse Dpt Protein, His (Fc)-Avi-tagged | +Inquiry |
Dpt-2647M | Recombinant Mouse Dpt Protein, Myc/DDK-tagged | +Inquiry |
DPT-2855H | Recombinant Human DPT Protein, GST-tagged | +Inquiry |
DPT-66H | Recombinant Human DPT protein, T7/His-tagged | +Inquiry |
DPT-1754HFL | Recombinant Full Length Human DPT Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *
0
Inquiry Basket