Recombinant Full Length Human DPY19L2P4 Protein, GST-tagged
| Cat.No. : | DPY19L2P4-4162HF |
| Product Overview : | Human DPY19L2P4 full-length ORF ( AAH47471.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 148 amino acids |
| Description : | DPY19L2P4 (DPY19L2 Pseudogene 4) is a Pseudogene. |
| Molecular Mass : | 43.4 kDa |
| AA Sequence : | MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLLGPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFLHQNG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPY19L2P4 DPY19L2 pseudogene 4 [ Homo sapiens (human) ] |
| Official Symbol | DPY19L2P4 |
| Synonyms | DPY19L2P4; DPY19L2 pseudogene 4; DPY19L2 Pseudogene 4; Dpy-19-Like 2 Pseudogene 4 (C. Elegans); dpy-19-like 2 pseudogene 4; FLJ25893; MGC39769; MGC48509; DKFZp686L2199 |
| Gene ID | 442523 |
| ◆ Recombinant Proteins | ||
| DPY19L2P4-2859H | Recombinant Human DPY19L2P4 Protein, GST-tagged | +Inquiry |
| DPY19L2P4-4162HF | Recombinant Full Length Human DPY19L2P4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPY19L2P4 Products
Required fields are marked with *
My Review for All DPY19L2P4 Products
Required fields are marked with *
