Recombinant Full Length Human DPY19L2P4 Protein, GST-tagged

Cat.No. : DPY19L2P4-4162HF
Product Overview : Human DPY19L2P4 full-length ORF ( AAH47471.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 148 amino acids
Description : DPY19L2P4 (DPY19L2 Pseudogene 4) is a Pseudogene.
Molecular Mass : 43.4 kDa
AA Sequence : MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLLGPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFLHQNG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPY19L2P4 DPY19L2 pseudogene 4 [ Homo sapiens (human) ]
Official Symbol DPY19L2P4
Synonyms DPY19L2P4; DPY19L2 pseudogene 4; DPY19L2 Pseudogene 4; Dpy-19-Like 2 Pseudogene 4 (C. Elegans); dpy-19-like 2 pseudogene 4; FLJ25893; MGC39769; MGC48509; DKFZp686L2199
Gene ID 442523

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPY19L2P4 Products

Required fields are marked with *

My Review for All DPY19L2P4 Products

Required fields are marked with *

0
cart-icon