Recombinant Human DPY19L2P4 Protein, GST-tagged

• Cat.No.: DPY19L2P4-2859H
• Product Overview: Human DPY19L2P4 full-length ORF ( AAH47471.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DPY19L2P4 (DPY19L2 Pseudogene 4) is a Pseudogene.
• Molecular Mass: 43.4 kDa
• AA Sequence: MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLLGPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFLHQNG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPY19L2P4 DPY19L2 pseudogene 4 [ Homo sapiens (human) ]
• Official Symbol: DPY19L2P4
• Synonyms: DPY19L2P4; DPY19L2 pseudogene 4; DPY19L2 Pseudogene 4; Dpy-19-Like 2 Pseudogene 4 (C. Elegans); dpy-19-like 2 pseudogene 4; FLJ25893; MGC39769; MGC48509; DKFZp686L2199
• Gene ID: 442523