Recombinant Full Length Human DPYSL2 Protein, GST-tagged
Cat.No. : | DPYSL2-6907HF |
Product Overview : | Recombinant Human full-length DPYSL2(1 a.a. - 572 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 572 amino acids |
Description : | This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 88.7 kDa |
AA Sequence : | MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTR FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVL SRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKM DENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAK QQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Name | DPYSL2 dihydropyrimidinase like 2 [ Homo sapiens (human) ] |
Official Symbol | DPYSL2 |
Synonyms | DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2 |
Gene ID | 1808 |
mRNA Refseq | NM_001386 |
Protein Refseq | NP_001377 |
MIM | 602463 |
UniProt ID | Q16555 |
◆ Recombinant Proteins | ||
DPYSL2-6907HF | Recombinant Full Length Human DPYSL2 Protein, GST-tagged | +Inquiry |
DPYSL2-1608R | Recombinant Rat DPYSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYSL2-102H | Recombinant Human DPYSL2, GST-tagged | +Inquiry |
DPYSL2-2520M | Recombinant Mouse DPYSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYSL2-1193H | Recombinant Full Length Human DPYSL2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYSL2 Products
Required fields are marked with *
My Review for All DPYSL2 Products
Required fields are marked with *
0
Inquiry Basket