| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    In Vitro Cell Free System | 
                                
                                
                                    | Tag : | 
                                    GST | 
                                
                                
                                    | Protein Length : | 
                                    572 amino acids | 
                                
                                
                                    | Description : | 
                                    This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. | 
                                
                                
                                    | Molecular Mass : | 
                                    88.7 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTR FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVL SRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKM DENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAK QQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG | 
                                
                                
                                    | Applications : | 
                                    ELISA; WB-Re; AP; Array | 
                                
                                
                                    | Notes : | 
                                    Best use within three months from the date of receipt of this protein. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
                                
                                
                                    | Storage Buffer : | 
                                    50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |