Recombinant Full Length Human DPYSL3 Protein, C-Flag-tagged
Cat.No. : | DPYSL3-415HFL |
Product Overview : | Recombinant Full Length Human DPYSL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-570 a.a. |
Description : | Enables filamin binding activity. Predicted to be involved in several processes, including actin filament organization; regulation of plasma membrane bounded cell projection organization; and response to axon injury. Predicted to act upstream of or within nervous system development. Predicted to be located in several cellular components, including cell body; growth cone; and lamellipodium. Predicted to be part of filamentous actin. Predicted to be active in synapse. Predicted to colocalize with exocytic vesicle. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI DVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD ITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQT RMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT ASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD LHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPP GGRSNITSLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DPYSL3 dihydropyrimidinase like 3 [ Homo sapiens (human) ] |
Official Symbol | DPYSL3 |
Synonyms | DRP3; ULIP; CRMP4; DRP-3; LCRMP; CRMP-4; ULIP-1 |
Gene ID | 1809 |
mRNA Refseq | NM_001387.3 |
Protein Refseq | NP_001378.1 |
MIM | 601168 |
UniProt ID | Q14195 |
◆ Recombinant Proteins | ||
DPYSL3-2708Z | Recombinant Zebrafish DPYSL3 | +Inquiry |
DPYSL3-1950R | Recombinant Rat DPYSL3 Protein | +Inquiry |
DPYSL3-788H | Recombinant Human DPYSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dpysl3-1741M | Recombinant Mouse Dpysl3 protein, His & T7-tagged | +Inquiry |
DPYSL3-1609R | Recombinant Rat DPYSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYSL3-6821HCL | Recombinant Human DPYSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYSL3 Products
Required fields are marked with *
My Review for All DPYSL3 Products
Required fields are marked with *
0
Inquiry Basket