Recombinant Full Length Human DUPD1 Protein, GST-tagged
Cat.No. : | DUPD1-4085HF |
Product Overview : | Human DUPD1 full-length ORF ( NP_001003892.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 220 amino acids |
Description : | DUPD1 (Dual Specificity Phosphatase And Pro Isomerase Domain Containing 1) is a Protein Coding gene. Diseases associated with DUPD1 include Cervix Carcinoma. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP13. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 [ Homo sapiens ] |
Official Symbol | DUPD1 |
Synonyms | DUPD1; dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUSP27; dual specificity phosphatase 27; atypical dual-specific protein phosphatase; FMDSP; |
Gene ID | 338599 |
mRNA Refseq | NM_001003892 |
Protein Refseq | NP_001003892 |
MIM | 618574 |
UniProt ID | Q68J44 |
◆ Recombinant Proteins | ||
DUPD1-1629R | Recombinant Rat DUPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dupd1-2677M | Recombinant Mouse Dupd1 Protein, Myc/DDK-tagged | +Inquiry |
DUPD1-12199H | Recombinant Human DUPD1, His-tagged | +Inquiry |
DUPD1-2557M | Recombinant Mouse DUPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUPD1-4038C | Recombinant Chicken DUPD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUPD1-6789HCL | Recombinant Human DUPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUPD1 Products
Required fields are marked with *
My Review for All DUPD1 Products
Required fields are marked with *