Recombinant Full Length Human DUSP10 Protein, GST-tagged
Cat.No. : | DUSP10-4089HF |
Product Overview : | Human DUSP10 full-length ORF ( AAH20608, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 140 amino acids |
Description : | Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAP kinase superfamily, which is associated with cellular proliferation and differentiation. Different members of this family of dual specificity phosphatases show distinct substrate specificities for MAP kinases, different tissue distribution and subcellular localization, and different modes of expression induction by extracellular stimuli. This gene product binds to and inactivates p38 and SAPK/JNK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 41.14 kDa |
AA Sequence : | MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP10 dual specificity phosphatase 10 [ Homo sapiens ] |
Official Symbol | DUSP10 |
Synonyms | DUSP10; dual specificity phosphatase 10; dual specificity protein phosphatase 10; MKP 5; MKP5; map kinase phosphatase 5; dual specificity phosphatase MKP-5; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 5; MKP-5; |
Gene ID | 11221 |
mRNA Refseq | NM_007207 |
Protein Refseq | NP_009138 |
MIM | 608867 |
UniProt ID | Q9Y6W6 |
◆ Recombinant Proteins | ||
DUSP10-1173R | Recombinant Rhesus Macaque DUSP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP10-1348R | Recombinant Rhesus monkey DUSP10 Protein, His-tagged | +Inquiry |
DUSP10-2724C | Recombinant Chicken DUSP10 | +Inquiry |
DUSP10-12203H | Recombinant Human DUSP10, GST-tagged | +Inquiry |
DUSP10-4089HF | Recombinant Full Length Human DUSP10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP10-6784HCL | Recombinant Human DUSP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP10 Products
Required fields are marked with *
My Review for All DUSP10 Products
Required fields are marked with *