Recombinant Full Length Human DUSP29 Protein, C-Flag-tagged

• Cat.No.: DUSP29-991HFL
• Product Overview: Recombinant Full Length Human DUSP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables protein homodimerization activity and protein tyrosine/serine/threonine phosphatase activity. Involved in protein dephosphorylation. Part of protein-containing complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 25.2 kDa
• AA Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ
  DGEEEDGRELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Phosphatase
• Full Length: Full L.

Gene Information

• Gene Name: DUSP29 dual specificity phosphatase 29 [ Homo sapiens (human) ]
• Official Symbol: DUSP29
• Synonyms: DUPD1; FMDSP; DUSP27
• Gene ID: 338599
• mRNA Refseq: NM_001003892.3
• Protein Refseq: NP_001003892.1
• MIM: 618574
• UniProt ID: Q68J44