Recombinant Full Length Human DUSP29 Protein, C-Flag-tagged
| Cat.No. : | DUSP29-991HFL |
| Product Overview : | Recombinant Full Length Human DUSP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables protein homodimerization activity and protein tyrosine/serine/threonine phosphatase activity. Involved in protein dephosphorylation. Part of protein-containing complex. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 25.2 kDa |
| AA Sequence : | MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ DGEEEDGRELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Phosphatase |
| Full Length : | Full L. |
| Gene Name | DUSP29 dual specificity phosphatase 29 [ Homo sapiens (human) ] |
| Official Symbol | DUSP29 |
| Synonyms | DUPD1; FMDSP; DUSP27 |
| Gene ID | 338599 |
| mRNA Refseq | NM_001003892.3 |
| Protein Refseq | NP_001003892.1 |
| MIM | 618574 |
| UniProt ID | Q68J44 |
| ◆ Recombinant Proteins | ||
| DUSP29-795H | Recombinant Human DUSP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DUSP29-991HFL | Recombinant Full Length Human DUSP29 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP29 Products
Required fields are marked with *
My Review for All DUSP29 Products
Required fields are marked with *



