Recombinant Full Length Human DUX4L8 Protein, GST-tagged

• Cat.No.: DUX4L8-4128HF
• Product Overview: Human DUX2 full-length ORF ( AAI56160.1, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 80 amino acids
• Description: This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length and a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. There is no evidence for transcription of the gene at this locus though RT-PCR and in vitro expression experiments indicate that a telomeric paralog of this gene is transcribed in some haplotypes. Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). [provided by RefSeq, Jun 2014]
• Molecular Mass: 8.8 kDa
• AA Sequence: MALPKPSDGTLPAEVQGRGQRRRLVWTPSQSKALQACFERNPYPGITTRERLAQAIGIPEPRVQILFQNERSCQLRQHWH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUX4L8 double homeobox 4 like 8 [ Homo sapiens (human) ]
• Official Symbol: DUX4L8
• Synonyms: DUX4L8; double homeobox 4 like 8; Double Homeobox 4 Like 8; Double Homeobox 4 Like 8 (Pseudogene); Double Homeobox 2; Putative Double Homeobox Protein 2; Double Homeobox, 2; DUX2; double homeobox 2; double homeobox 4 like 8 (pseudogene); double homeobox, 4-like; putative double homeobox protein 2
• Gene ID: 26583
• MIM: 611442