Recombinant Full Length Human DUX4L8 Protein, GST-tagged
| Cat.No. : | DUX4L8-4128HF |
| Product Overview : | Human DUX2 full-length ORF ( AAI56160.1, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 80 amino acids |
| Description : | This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length and a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. There is no evidence for transcription of the gene at this locus though RT-PCR and in vitro expression experiments indicate that a telomeric paralog of this gene is transcribed in some haplotypes. Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). [provided by RefSeq, Jun 2014] |
| Molecular Mass : | 8.8 kDa |
| AA Sequence : | MALPKPSDGTLPAEVQGRGQRRRLVWTPSQSKALQACFERNPYPGITTRERLAQAIGIPEPRVQILFQNERSCQLRQHWH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DUX4L8 double homeobox 4 like 8 [ Homo sapiens (human) ] |
| Official Symbol | DUX4L8 |
| Synonyms | DUX4L8; double homeobox 4 like 8; Double Homeobox 4 Like 8; Double Homeobox 4 Like 8 (Pseudogene); Double Homeobox 2; Putative Double Homeobox Protein 2; Double Homeobox, 2; DUX2; double homeobox 2; double homeobox 4 like 8 (pseudogene); double homeobox, 4-like; putative double homeobox protein 2 |
| Gene ID | 26583 |
| MIM | 611442 |
| ◆ Recombinant Proteins | ||
| DUX4L8-2954H | Recombinant Human DUX4L8 Protein, GST-tagged | +Inquiry |
| DUX4L8-4128HF | Recombinant Full Length Human DUX4L8 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUX4L8 Products
Required fields are marked with *
My Review for All DUX4L8 Products
Required fields are marked with *
