Recombinant Human DUX4L8 Protein, GST-tagged

Cat.No. : DUX4L8-2954H
Product Overview : Human DUX2 full-length ORF ( AAI56160.1, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length and a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. There is no evidence for transcription of the gene at this locus though RT-PCR and in vitro expression experiments indicate that a telomeric paralog of this gene is transcribed in some haplotypes. Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). [provided by RefSeq, Jun 2014]
Molecular Mass : 8.8 kDa
AA Sequence : MALPKPSDGTLPAEVQGRGQRRRLVWTPSQSKALQACFERNPYPGITTRERLAQAIGIPEPRVQILFQNERSCQLRQHWH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUX4L8 double homeobox 4 like 8 [ Homo sapiens (human) ]
Official Symbol DUX4L8
Synonyms DUX4L8; double homeobox 4 like 8; Double Homeobox 4 Like 8; Double Homeobox 4 Like 8 (Pseudogene); Double Homeobox 2; Putative Double Homeobox Protein 2; Double Homeobox, 2; DUX2; double homeobox 2; double homeobox 4 like 8 (pseudogene); double homeobox, 4-like; putative double homeobox protein 2
Gene ID 26583
MIM 611442

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUX4L8 Products

Required fields are marked with *

My Review for All DUX4L8 Products

Required fields are marked with *

0
cart-icon
0
compare icon