Recombinant Full Length Human DYNLL1 Protein, GST-tagged
Cat.No. : | DYNLL1-4155HF |
Product Overview : | Human DYNLL1 full-length ORF ( NP_003737.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 89 amino acids |
Description : | Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYNLL1 dynein, light chain, LC8-type 1 [ Homo sapiens ] |
Official Symbol | DYNLL1 |
Synonyms | DYNLL1; dynein, light chain, LC8-type 1; DNCL1, dynein, cytoplasmic, light polypeptide 1; dynein light chain 1, cytoplasmic; DLC1; DLC8; hdlc1; LC8; PIN; 8 kDa dynein light chain; cytoplasmic dynein light polypeptide; dynein, cytoplasmic, light polypeptide 1; protein inhibitor of neuronal nitric oxide synthase; LC8a; DNCL1; DNCLC1; MGC126137; MGC126138; |
Gene ID | 8655 |
mRNA Refseq | NM_001037494 |
Protein Refseq | NP_001032583 |
MIM | 601562 |
UniProt ID | P63167 |
◆ Recombinant Proteins | ||
DYNLL1-2583M | Recombinant Mouse DYNLL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNLL1-12264Z | Recombinant Zebrafish DYNLL1 | +Inquiry |
DYNLL1-1360R | Recombinant Rhesus monkey DYNLL1 Protein, His-tagged | +Inquiry |
Dynll1-2698M | Recombinant Mouse Dynll1 Protein, Myc/DDK-tagged | +Inquiry |
DYNLL1-2257H | Recombinant Human DYNLL1 Protein (Met1-Gly89), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLL1-6757HCL | Recombinant Human DYNLL1 293 Cell Lysate | +Inquiry |
DYNLL1-6758HCL | Recombinant Human DYNLL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLL1 Products
Required fields are marked with *
My Review for All DYNLL1 Products
Required fields are marked with *
0
Inquiry Basket