Recombinant Full Length Human DYNLRB1 Protein, GST-tagged
Cat.No. : | DYNLRB1-4159HF |
Product Overview : | Human DNCL2A full-length ORF ( AAH02481, 22 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 22-96 amino acids |
Description : | This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 33.99 kDa |
AA Sequence : | VVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYNLRB1 dynein, light chain, roadblock-type 1 [ Homo sapiens ] |
Official Symbol | DYNLRB1 |
Synonyms | DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A; |
Gene ID | 83658 |
mRNA Refseq | NM_014183 |
Protein Refseq | NP_054902 |
MIM | 607167 |
UniProt ID | Q9NP97 |
◆ Recombinant Proteins | ||
DYNLRB1-1989R | Recombinant Rat DYNLRB1 Protein | +Inquiry |
DYNLRB1-2750H | Recombinant Human DYNLRB1, His-tagged | +Inquiry |
DYNLRB1-2584M | Recombinant Mouse DYNLRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNLRB1-1114H | Recombinant Human DYNLRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DYNLRB1-4800H | Recombinant Human DYNLRB1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLRB1-6755HCL | Recombinant Human DYNLRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLRB1 Products
Required fields are marked with *
My Review for All DYNLRB1 Products
Required fields are marked with *