Recombinant Full Length Human DYNLT3 Protein, GST-tagged
| Cat.No. : | DYNLT3-4168HF |
| Product Overview : | Human DYNLT3 full-length ORF ( ACT64502.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 116 amino acids |
| Description : | This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.[provided by RefSeq, Mar 2010] |
| Molecular Mass : | 12.8 kDa |
| AA Sequence : | MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DYNLT3 dynein light chain Tctex-type 3 [ Homo sapiens (human) ] |
| Official Symbol | DYNLT3 |
| Synonyms | DYNLT3; dynein light chain Tctex-type 3; Dynein Light Chain Tctex-Type 3; Protein 91/23; TCTE1L; T-Complex-Associated-Testis-Expressed 1-Like; T-Complex-Associated Testis-Expressed 1-Like; TCTEX1L; TCTE1XL; RP3; dynein light chain Tctex-type 3; protein 91/23 |
| Gene ID | 6990 |
| mRNA Refseq | NM_006520 |
| Protein Refseq | NP_006511 |
| MIM | 300302 |
| UniProt ID | P51808 |
| ◆ Recombinant Proteins | ||
| DYNLT3-4168HF | Recombinant Full Length Human DYNLT3 Protein, GST-tagged | +Inquiry |
| DYNLT3-2980H | Recombinant Human DYNLT3 Protein, GST-tagged | +Inquiry |
| DYNLT3-2590M | Recombinant Mouse DYNLT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DYNLT3-5102C | Recombinant Chicken DYNLT3 | +Inquiry |
| Dynlt3-2702M | Recombinant Mouse Dynlt3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DYNLT3-6753HCL | Recombinant Human DYNLT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLT3 Products
Required fields are marked with *
My Review for All DYNLT3 Products
Required fields are marked with *
