Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Rnf128(Rnf128) Protein, His-Tagged
Cat.No. : | RFL11615HF |
Product Overview : | Recombinant Full Length Human E3 ubiquitin-protein ligase RNF128(RNF128) Protein (Q8TEB7) (39-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (39-428) |
Form : | Lyophilized powder |
AA Sequence : | AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPM SHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFII TAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCA VCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSL QVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSV AVDVIPHVDNPTFEEDETPNQETAVREIKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RNF128 |
Synonyms | RNF128; E3 ubiquitin-protein ligase RNF128; Gene related to anergy in lymphocytes protein; GRAIL; RING finger protein 128; RING-type E3 ubiquitin transferase RNF128 |
UniProt ID | Q8TEB7 |
◆ Recombinant Proteins | ||
RNF128-2658H | Recombinant Human RNF128 Protein, His-tagged | +Inquiry |
RFL27993MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf128(Rnf128) Protein, His-Tagged | +Inquiry |
RFL2786PF | Recombinant Full Length Pongo Abelii E3 Ubiquitin-Protein Ligase Rnf128(Rnf128) Protein, His-Tagged | +Inquiry |
RNF128-3928R | Recombinant Rhesus monkey RNF128 Protein, His-tagged | +Inquiry |
RNF128-301144H | Recombinant Human RNF128 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF128 Products
Required fields are marked with *
My Review for All RNF128 Products
Required fields are marked with *
0
Inquiry Basket