Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Rnf152(Rnf152) Protein, His-Tagged
Cat.No. : | RFL25600HF |
Product Overview : | Recombinant Full Length Human E3 ubiquitin-protein ligase RNF152(RNF152) Protein (Q8N8N0) (1-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-203) |
Form : | Lyophilized powder |
AA Sequence : | METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR LLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RNF152 |
Synonyms | RNF152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152 |
UniProt ID | Q8N8N0 |
◆ Recombinant Proteins | ||
RFL25600HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Rnf152(Rnf152) Protein, His-Tagged | +Inquiry |
RNF152-7661M | Recombinant Mouse RNF152 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF152-14313M | Recombinant Mouse RNF152 Protein | +Inquiry |
RFL15977DF | Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase Rnf152(Rnf152) Protein, His-Tagged | +Inquiry |
RNF152-5074R | Recombinant Rat RNF152 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF152-2290HCL | Recombinant Human RNF152 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF152 Products
Required fields are marked with *
My Review for All RNF152 Products
Required fields are marked with *
0
Inquiry Basket