Recombinant Full Length Human EBF4 Protein, GST-tagged

• Cat.No.: EBF4-4143HF
• Product Overview: Human EBF4 full-length ORF ( AAH54347.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 88 amino acids
• Description: EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 35.5 kDa
• AA Sequence: MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EBF4 early B-cell factor 4 [ Homo sapiens (human) ]
• Official Symbol: EBF4
• Synonyms: EBF4; early B-cell factor 4; Early B-Cell Factor 4; Olf-1/EBF-Like 4; O/E-4; COE4; OE-4; Transcription Factor COE4; KIAA1442; EBF-4; transcription factor COE4; olf-1/EBF-like 4
• Gene ID: 57593
• mRNA Refseq: NM_001110514
• Protein Refseq: NP_001103984
• MIM: 609935
• UniProt ID: Q9BQW3